PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G14840.1
Common NameLOC102706628
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 324aa    MW: 35088.5 Da    PI: 9.551
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G14840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.68.4e-3965142178
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   +CqvegC  +l  +k+yhr+h+vC +hsk p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL +hn+rrrk+q+
  OB02G14840.1  65 RCQVEGCGLELVGVKDYHRKHRVCVAHSKFPRVIVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLYDHNARRRKPQT 142
                   6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-3258127IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.00963140IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.07E-3764145IPR004333Transcription factor, SBP-box
PfamPF031101.2E-2966139IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDWMAPPKPT SPPLLWDWAD AAVPGSSGEA AAAAAAPGRR RKEKRARAEE VGGGGGGGGG  60
GEKVRCQVEG CGLELVGVKD YHRKHRVCVA HSKFPRVIVA GQERRFCQQC SRFHALSEFD  120
QKKRSCRRRL YDHNARRRKP QTDAFSFAAA RVPLSLLFDD SREISFVWNK DLLSQVKPFA  180
VSPWESSSEV GTTDGHIYLD KSHLSKSLPT FNTNIYELLR MKGPDASITA SKFDGAPDLQ  240
HALSLLSASS SGLPDPVQQA SRLIQFTGGS QNSRGLPPLH GGNSGSASCA DVQPTAQPAH  300
LVRFTMGASS NACESNFFSL NQIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2355139184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13843RRRKEK
2121138KKRSCRRRLYDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0614841e-180AK061484.1 Oryza sativa Japonica Group cDNA clone:006-308-H09, full insert sequence.
GenBankAK0687021e-180AK068702.1 Oryza sativa Japonica Group cDNA clone:J013159I15, full insert sequence.
GenBankCT8287411e-180CT828741.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA126O04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646951.10.0PREDICTED: squamosa promoter-binding-like protein 4 isoform X1
SwissprotQ6H5091e-116SPL4_ORYSJ; Squamosa promoter-binding-like protein 4
TrEMBLJ3LA170.0J3LA17_ORYBR; Uncharacterized protein
STRINGOB02G14840.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.38e-41squamosa promoter binding protein-like 2